PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462951893
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-PHD
Protein Properties Length: 640aa    MW: 70392.8 Da    PI: 4.3575
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462951893genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.73.5e-12447494754
                --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                f++   ++L e+F+ ++yps++ +e LAk+lg+t +qV+ WF  rR k
  462951893 447 FSPIINQRLYEHFKTEKYPSRDVKESLAKELGITSCQVSRWFETRRRK 494
                55666689**************************************98 PP

2PHD41.62.8e-1480135151
                SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
        PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                +C+ Cg+   + +++++lCdg C++ fH++Cl+++l +e++p+g   wlC+ C++k
  462951893  80 FCATCGSkdVTLNNDIILCDGvCDRGFHQNCLSPPLLTEDIPDGdeGWLCPACDCK 135
                7******64445********77*********************999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579033.77E-1371138IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.105.9E-1377134IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.11978135IPR019787Zinc finger, PHD-finger
PfamPF006281.6E-1180135IPR019787Zinc finger, PHD-finger
CDDcd155041.00E-2580132No hitNo description
SMARTSM002495.1E-1180133IPR001965Zinc finger, PHD-type
PROSITE patternPS01359081132IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007113.653438498IPR001356Homeobox domain
SuperFamilySSF466892.57E-11441495IPR009057Homeodomain-like
SMARTSM003891.3E-11441502IPR001356Homeobox domain
PfamPF000461.9E-9447494IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.3E-11447505IPR009057Homeodomain-like
CDDcd000867.48E-12447494No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
LPGAGESGSA FWGFWFLAFL CQLLEKIRPE KELERAKGQI LMYKLRIREV FQNLDSLLSK  60
GKIDESLFDS DGEIACEDIF CATCGSKDVT LNNDIILCDG VCDRGFHQNC LSPPLLTEDI  120
PDGDEGWLCP ACDCKIDCID VINKLQGSDL SIYDSWEKVF PEAAALANGS KQDEAFDLPS  180
DDSEDDDFDP EKAEEHKHVA SKEEGSSEED GDEGSDSDDS NFLTSSDSEP LMDKKKADDL  240
GLPSEDSEDD DYDPAGPDSD KDIQKEKTSS DESDFTSDSD EFCTEIAKSG DHDEVSKPSL  300
PDAEAGDTTC DMEKSTAQAN TANSSLNSME TDMDQSLVLP GSGRRKVERL DYKKLYDETY  360
DKESLDSSDD EEWSGNSTPE KGNEEPSEAE ANPSAVKSSR RTRVASHNDE LTPQTVHPDS  420
LHGSADQKCG GDLTSNGSNS TTRKGQFSPI INQRLYEHFK TEKYPSRDVK ESLAKELGIT  480
SCQVSRWFET RRRKAASKSL SRDNHSAEET NSPAVASTQV KDPEGTVMEK PDVSRIEKEN  540
EGATSGKLNE VCKKTSVLIN RIKRGRRSAA TPPGSKQVHA KNLSSPKGGS GDNHHMDASI  600
RDAIRSNGNP SEDQIPEVDL VDEARKKAIQ RELKKKKMGR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1342349GRRKVERL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961485.10.0PREDICTED: homeobox protein HOX1A-like
SwissprotP466050.0HOX1A_MAIZE; Homeobox protein HOX1A
TrEMBLA0A0A9GE960.0A0A0A9GE96_ARUDO; Hox1a
STRINGSi021365m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43933768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.13e-64Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain